Protein Info for Rru_A2503 in Rhodospirillum rubrum S1H

Annotation: Hydroxypyruvate isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to OTNI_PECAS: 2-oxo-tetronate isomerase (otnI) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01816, hydroxypyruvate isomerase [EC: 5.3.1.22] (inferred from 100% identity to rru:Rru_A2503)

Predicted SEED Role

"Hydroxypyruvate isomerase (EC 5.3.1.22)" (EC 5.3.1.22)

KEGG Metabolic Maps

Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRE2 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Rru_A2503 Hydroxypyruvate isomerase (NCBI) (Rhodospirillum rubrum S1H)
MPRFAANLSTLFTDRPLEERFAAAAACGFRGVELQFPYTLAPERLGDLAAMNRLDVVLFN
APPGDWAAGERGLAALPGRQSEFRDSLEVVLPYVELAGCERVHVMAGVVAEDDWPVALET
YVENLAYAADLFAERGVKVLIEAVNTEDMPGYFLSRPDDALQVIEEVGHKNLHVLYDFYH
AQIVQGGLTDFLESNIERIAHVQVAGVPGRREPDANGEINWPYLFNLLDAHGFPGWVGCE
YTPRAGTEAGLRWARDFGISAPAA