Protein Info for Rru_A2492 in Rhodospirillum rubrum S1H

Annotation: Glycosyl transferase, group 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 15 to 172 (158 residues), 75.5 bits, E=1.6e-24
• PF13579: Glyco_trans_4_4
  • amino acids 15 to 170 (156 residues), 51.9 bits, E=3.4e-17
• PF20706: GT4-conflict
  • amino acids 156 to 293 (138 residues), 33.2 bits, E=8.9e-12
• PF13692: Glyco_trans_1_4
  • amino acids 192 to 333 (142 residues), 107.1 bits, E=2.7e-34
• PF00534: Glycos_transf_1
  • amino acids 193 to 346 (154 residues), 118.2 bits, E=8.9e-38
• PF13524: Glyco_trans_1_2
  • amino acids 272 to 362 (91 residues), 34.7 bits, E=5.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2492)

Predicted SEED Role

"Alpha-1,4-N-acetylgalactosamine transferase PglH (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See Q2RRF3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Rru_A2492 Glycosyl transferase, group 1 (NCBI) (Rhodospirillum rubrum S1H)
MKIVMVIKGLHETAGGAERIFCDVANHLAGRGHRVGVLSFDSPGEEPFYDLSGVDDVVGL
AIGDVHRPTSPLIFQRRVSALRREILARRPDVVIAFMHSCFVPTALALIGTGIPVVASEH
TVITHYRKRLGQLALYALSVPLLRSITVVSQAVKERFPRVIRRKMVVMPNPVALPAAVPE
PALDAPPGRPARRILSIGRFDEAKGHGVLLEAFARIARDFPEWDLRIVGDGPTREALRQR
AIALGLSERVAMPGIVRNIAAEWQACAVFALASRYESFGLVIAEAMAAGRPAIGFIDCPG
VNTLIEDGRTGLLVGGEDRPAALAAGLWRLLSDPDLRQTMGAAAREAIAGQFHIERICDQ
WEALLSETLDP