Protein Info for Rru_A2491 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 85 to 115 (31 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 334 to 359 (26 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 44 to 349 (306 residues), 52 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2491)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRF4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Rru_A2491 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MRLPFLSRFFAGIDPRGPEAFLLLSAAAQPVAFSTWQALLNNFAIERASFSGADMGLLQS
LREVPGLLALTVIFFLLVLREQTLLIVSLVLLGVGTAITGLFPSVLGLFITTIVMSIGFH
YQETLQQSLTLQWIDRERAAPAMGRQIAARGAAGLIAFAGVWLMLDVYGLDYAWVYAFGG
ALTVILALAAWMAYPRFPDAALQTKKLFLRKRYWLFYALTFMSGARRQIFTVFAGFMMVE
KFGYSAAQVTLLFIVNQAINMVFAGRIGAAIGRWGERRALSLEYAGLIGVFVAYAVVENP
YAAAGLYIIDNLLFSMAIAIRSYFQKIAAPADIAASSGVSFTINHIAAVGIPGAFGLLWL
TNPAAVFLTGAAMAAISLTLARLVPEHPEPGHETLFARRQKAVAH