Protein Info for Rru_A2486 in Rhodospirillum rubrum S1H

Annotation: Glucokinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF02685: Glucokinase" amino acids 9 to 320 (312 residues), 318.5 bits, see alignment E=2.1e-99 TIGR00749: glucokinase" amino acids 9 to 317 (309 residues), 255 bits, see alignment E=5.1e-80

Best Hits

Swiss-Prot: 52% identical to GLK_MAGSA: Glucokinase (glk) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to rru:Rru_A2486)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRF9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Rru_A2486 Glucokinase (NCBI) (Rhodospirillum rubrum S1H)
MAEPFIPGLIADIGGTNARFALTTPEGGWRDERVYRCAAFPGPAEAAAHYLAEVLTAFEP
RPDRGAICVACPVNGDHLALTNHGAWSFSISAVADRLGLAPFHAVNDFIANALAIPRLGP
SGLIEIGGGAGLTGAPIAAIGPGTGLGVAILIPGRGGNRTSPLATEGGHVTLPAVTDREA
VIISALRAIHGHASAERAISGPGLVWLSEAIRAADGLEPVAETPPSVMEKGLARSCPVCA
EAVDTFYALLGTVAGNLVLSTGAQGGVYLMGGILPRHPEALRTSAFLARFHEKGRFRDYL
DVVPIRLVTHPYPAFIGLAGLVSD