Protein Info for Rru_A2462 in Rhodospirillum rubrum S1H

Annotation: Enzymatic protein of unknown function (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 246 to 263 (18 residues), see Phobius details TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 7 to 296 (290 residues), 311.8 bits, see alignment E=2.3e-97 PF04107: GCS2" amino acids 8 to 292 (285 residues), 192.3 bits, see alignment E=6.3e-61

Best Hits

Swiss-Prot: 100% identical to GCS2_RHORT: Putative glutamate--cysteine ligase 2 (Rru_A2462) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 100% identity to rru:Rru_A2462)

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRI3 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Rru_A2462 Enzymatic protein of unknown function (NCBI) (Rhodospirillum rubrum S1H)
MREPAFTVGIEEEYLLVDRQSRALAADPPEALMTRLAAAFGDTNHGAVTPEFLRAQIEVG
TKVCDSLAEAGEALGALRRVLAEEAKGFGLAPIAASTHPFAEWADLKHTPKERYDLLAED
LQAVVRRLVICGMHVHVGIEDPDLRMDLMAQVSYFLPHLLALTTSSPFWRGEDSGLKSYR
IAVFSALPRTGLPDSFSSFAEYQRHVEVLVSAGLIEDSTRIWWDIRPSHRFPTLEMRIAD
VCTRLDDALCVAALFRCLLRMLYRLRRANQRWRHYARLLIAENRWRAQRYGLDGGLVDFG
RGEVVPFADLIEELLELIAPDAAVFGCQAEVLHARTILHRGTSAHNQLRVFAEARAGGMT
RDEALVAVVDHLIAQTVAPLGADAGAPGP