Protein Info for Rru_A2417 in Rhodospirillum rubrum S1H

Annotation: Lipoprotein YaeC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00363: lipoprotein, YaeC family" amino acids 10 to 259 (250 residues), 281.2 bits, see alignment E=4.4e-88 PF03180: Lipoprotein_9" amino acids 27 to 262 (236 residues), 320.6 bits, see alignment E=2.5e-100

Best Hits

Swiss-Prot: 59% identical to METQ_YERPE: D-methionine-binding lipoprotein MetQ (metQ) from Yersinia pestis

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A2417)

MetaCyc: 56% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRM8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Rru_A2417 Lipoprotein YaeC (NCBI) (Rhodospirillum rubrum S1H)
MRFLKTIAAAAILATGFAAPGFADTKIKVGVTPGEHEEVMEQVKALAKDKGLDVEIVTFS
DYVLPNQALNDGDLQLNSFQHVPYLENQIKDRGYKLSVVGKNFVTPMGVYSEKLKSLDAL
PEGARFALPNDPTNGGRALLLLQAKGVITLKDGAGLSVTPADVVGNPKKLKFIELDAAQL
PRSLPDVDAAAINTNYALDAGLNPTDDAIAIESAESPYTNVIVARTQDKDAEWVKAFVAV
YQSEPIRKFILDTYKGAVLPVF