Protein Info for Rru_A2407 in Rhodospirillum rubrum S1H

Annotation: GCN5-related N-acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF13302: Acetyltransf_3" amino acids 4 to 147 (144 residues), 28.8 bits, see alignment E=4.5e-10 PF13420: Acetyltransf_4" amino acids 13 to 164 (152 residues), 39.1 bits, see alignment E=1.9e-13 PF00583: Acetyltransf_1" amino acids 55 to 146 (92 residues), 51.8 bits, see alignment E=2.3e-17 PF13508: Acetyltransf_7" amino acids 57 to 148 (92 residues), 38.1 bits, see alignment E=4e-13 PF13673: Acetyltransf_10" amino acids 92 to 150 (59 residues), 23.7 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 45% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to rru:Rru_A2407)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRN8 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Rru_A2407 GCN5-related N-acetyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MTTLTIRPARPDDDALAIQAIYAPYVLTSTATFENVPPSVDDMAGRLRTLVEGGYPVLVA
EESGEGAPPRIVGYAYAGPYHKRPAYRATLENSIYVDSQCRRGGVGAALMTRLLAEAAER
GFRQVIAVIGDADNTASRQFHLRQGFREAGMIAAVGWKFGRWLDVFYYQITLGAGSDQPP
ADEGPASPSGPPTFR