Protein Info for Rru_A2403 in Rhodospirillum rubrum S1H
Annotation: Inositol phosphatase/fructose-1,6-bisphosphatase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to F16PA_RHORT: Fructose-1,6-bisphosphatase class 1 (fbp) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to rru:Rru_A2403)MetaCyc: 46% identical to fructose-1,6-bisphosphatase (Arabidopsis thaliana col)
Fructose-bisphosphatase. [EC: 3.1.3.11]
Predicted SEED Role
"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)
MetaCyc Pathways
- Calvin-Benson-Bassham cycle (12/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- gluconeogenesis III (10/12 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- oxygenic photosynthesis (13/17 steps found)
- gluconeogenesis I (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
- superpathway of N-acetylneuraminate degradation (13/22 steps found)
KEGG Metabolic Maps
- Biosynthesis of phenylpropanoids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.11
Use Curated BLAST to search for 3.1.3.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RRP2 at UniProt or InterPro
Protein Sequence (369 amino acids)
>Rru_A2403 Inositol phosphatase/fructose-1,6-bisphosphatase (NCBI) (Rhodospirillum rubrum S1H) MSVLSQDRPRERPPMLATDRTTLAQFLVEECRGRAGDDSELLGLLLDVAQACKTISKMTA MGSLAGVHGYNGDVNPQGENQARLDLMSNQAFVRATERTGHAAGLASEEMEEVLGFPESY ARGTLLLVFDPLDGSSNIDINGTVGSIFSILPMPRPGEAPQTADFLQSGRQQVAAGYALY GPSTMFVLTIGSGVHGFTLDPLLGDFILTHPSMTVIPESGEFAINSSNSRFWEPPIRAYV DELLAGRSGPRSKDYNMRWIAALVADVHRILLRGGIYLYPRDTKTPDLAGRLRLLYEAAP VAFLMEQAGGRCTTGTRTMLDLVPGSLHERVPLIFGSAVEVERVETLYREPQRREFATPL FNQRGLFRD