Protein Info for Rru_A2403 in Rhodospirillum rubrum S1H

Annotation: Inositol phosphatase/fructose-1,6-bisphosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00316: FBPase" amino acids 22 to 211 (190 residues), 179.3 bits, see alignment E=6.7e-57 PF18913: FBPase_C" amino acids 218 to 348 (131 residues), 153 bits, see alignment E=3.7e-49

Best Hits

Swiss-Prot: 100% identical to F16PA_RHORT: Fructose-1,6-bisphosphatase class 1 (fbp) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to rru:Rru_A2403)

MetaCyc: 46% identical to fructose-1,6-bisphosphatase (Arabidopsis thaliana col)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRP2 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Rru_A2403 Inositol phosphatase/fructose-1,6-bisphosphatase (NCBI) (Rhodospirillum rubrum S1H)
MSVLSQDRPRERPPMLATDRTTLAQFLVEECRGRAGDDSELLGLLLDVAQACKTISKMTA
MGSLAGVHGYNGDVNPQGENQARLDLMSNQAFVRATERTGHAAGLASEEMEEVLGFPESY
ARGTLLLVFDPLDGSSNIDINGTVGSIFSILPMPRPGEAPQTADFLQSGRQQVAAGYALY
GPSTMFVLTIGSGVHGFTLDPLLGDFILTHPSMTVIPESGEFAINSSNSRFWEPPIRAYV
DELLAGRSGPRSKDYNMRWIAALVADVHRILLRGGIYLYPRDTKTPDLAGRLRLLYEAAP
VAFLMEQAGGRCTTGTRTMLDLVPGSLHERVPLIFGSAVEVERVETLYREPQRREFATPL
FNQRGLFRD