Protein Info for Rru_A2303 in Rhodospirillum rubrum S1H

Annotation: Deoxyribose-phosphate aldolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00126: deoxyribose-phosphate aldolase
  • amino acids 15 to 224 (210 residues), 268.3 bits, E=2e-84
• PF01791: DeoC
  • amino acids 18 to 217 (200 residues), 78.4 bits, E=3.3e-26

Best Hits

Swiss-Prot: 100% identical to DEOC_RHORT: Deoxyribose-phosphate aldolase (deoC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to rru:Rru_A2303)

MetaCyc: 52% identical to deoxyribose-phosphate aldolase (Yersinia sp. EA015)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

• superpathway of purine deoxyribonucleosides degradation (5/7 steps found)
• 2-deoxy-D-ribose degradation I (2/3 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

See Q2RRZ2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Rru_A2303 Deoxyribose-phosphate aldolase (NCBI) (Rhodospirillum rubrum S1H)
MTEPTNTLPNLGAAELAAYIDHTLLRPDAGAAEIAAWCDEAVTHGFKSVCVNPIQIPLVA
AKLAGTGVGVCSVIGFPFGASPTAVKVAEAAWVVAHGATEVDMVIDIGALKDGRAEAVRD
DIAAVKAACGKALLKVIIEACLLDDEQKALACRLSAEAGADFVKTSTGFAGGGATAKDVA
LMRRTVGSALGVKASGGVRTRDDALRMIAAGASRIGASASIAIVAEADAASTGAKGGY