Protein Info for Rru_A2269 in Rhodospirillum rubrum S1H

Annotation: Pyruvate carboxyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR02660: homocitrate synthase" amino acids 6 to 368 (363 residues), 519.7 bits, see alignment E=2.5e-160 PF00682: HMGL-like" amino acids 6 to 263 (258 residues), 264.4 bits, see alignment E=6.1e-83

Best Hits

Swiss-Prot: 54% identical to NIFV_AZOVI: Homocitrate synthase (nifV) from Azotobacter vinelandii

KEGG orthology group: K01655, homocitrate synthase [EC: 2.3.3.14] K02594, homocitrate synthase NifV (inferred from 100% identity to rru:Rru_A2269)

MetaCyc: 54% identical to homocitrate synthase monomer (Azotobacter vinelandii)
Homocitrate synthase. [EC: 2.3.3.14]

Predicted SEED Role

"Homocitrate synthase (EC 2.3.3.14)" in subsystem Nitrogen fixation (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS26 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Rru_A2269 Pyruvate carboxyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MDWSSVIVNDTTLRDGEQTAGVIFTLGEKVAIAKALERAGVPEMEVGIPAMGPEEQESIR
AVVAQCEASRPIAWCRMHMTDLDAAAACGVDMVNLSIPVSDQQIKGKLGRDRGWVLAHLE
TMIKTALEKGLEVALGGEDSSRADPEFLLRVIERAEASGARRFRFADTLGIMDPFTTLQM
FKRLRAASGLELEIHAHDDLGLATANSLGAVLGGATHVSTTVNGLGERAGNAPLEEVVMA
CRNLYGRHTGIAPMALAAVSKLVAEASGRPVPANKPIVGEAIFTHESGIHVSGLLRDPKN
YEALSPADLGRCHRLVLGKHSGVASIVHACNALGLAPGEAQARAMLARVRLHAGATKRPP
TDADLRRFFDETRSVAEAIETLDFSRPPQAAS