Protein Info for Rru_A2252 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 9 to 117 (109 residues), 57.6 bits, see alignment E=7.3e-20 PF00528: BPD_transp_1" amino acids 28 to 222 (195 residues), 80.5 bits, see alignment E=6.8e-27

Best Hits

Swiss-Prot: 42% identical to HISQ_SALTI: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhi

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A2252)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS43 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Rru_A2252 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MDFQGYGDLLITGAAMTIKLVLGAVSFGLVLGLIGTTLKLSRNALARAVGNAYTDLFRGL
PELLVVLIMYYGAEALVRWLVNDVLALDVAVSISPYVGGVLSLGLIFGAYASEVFRGAIL
AIPRGHVEAARAFGMGPVLTYRRIILPQVWRVALPGLGNLFLVSLKDTALVSAIGLNELM
RSANIAGRSTRDYFTFLLAAAFLYLAMTMVSMAVIALLERRANRGHVGAAGH