Protein Info for Rru_A2249 in Rhodospirillum rubrum S1H

Annotation: Threonine aldolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01212: Beta_elim_lyase
  • amino acids 4 to 295 (292 residues), 162.8 bits, E=5.9e-52

Best Hits

Swiss-Prot: 42% identical to LTAE_PSEUN: Low specificity L-threonine aldolase (ltaE) from Pseudomonas sp. (strain NCIMB 10558)

KEGG orthology group: K01620, threonine aldolase [EC: 4.1.2.5] (inferred from 100% identity to rru:Rru_A2249)

Predicted SEED Role

No annotation

MetaCyc Pathways

• glycine biosynthesis IV (1/1 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• L-threonine degradation IV (1/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.5

Sequence Analysis Tools

See Q2RS46 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Rru_A2249 Threonine aldolase (NCBI) (Rhodospirillum rubrum S1H)
MVNLCSDNVAGALPAVLDALVEAGRGAAMPYGADPWSARLDALVAEIFERPAMVFPVATG
TAANSLALACLTPPWGAVYCHDEAHVMVDECGAPEFFTGGAKLIGIGGRDSRLDPQALRA
AVTQAAGSDHPVHVARPSAVTITTVSEGGTLYAPADVAAIADVCRTFSLGLHMDGARFAG
TLAALGCSPADLTWKAGVDILSLGATKGGALAAEAVVVFDPALAETLAYRRKKSGHLVSK
MRFLSAQLVAWLSEGRWLSAARHANGLAQRLGAGLDTVPGARLVAPVEANMAFVAFDQPL
SDGLRGRGHAFYPWPAHGPQAVRLVTSFETTDEDVEAFLADARAIAAGR