Protein Info for Rru_A2237 in Rhodospirillum rubrum S1H

Annotation: TRAP dicarboxylate transporter, DctM subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 272 to 298 (27 residues), see Phobius details amino acids 314 to 343 (30 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 395 to 420 (26 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 315.2 bits, see alignment E=3.2e-98 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 350.2 bits, see alignment E=6.6e-109

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2237)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS58 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Rru_A2237 TRAP dicarboxylate transporter, DctM subunit (NCBI) (Rhodospirillum rubrum S1H)
MATLSLFAVFLGLTLLGAPLAVALGLAGSVAILEAQLGILSVPTTVYAGIAKYPLLAIPV
FILAGLIFERVGVARQLVSFASSIVGARNGGLAIVAVLVCMVMGGISGSGPADAAAVATV
MIPSLHKAGYPKAFSASVIAAGAATAILIPPSVAFIIYSVLVPQASVPALFAGGLIPGLL
AGLSLLAPIVYLSRRHGFGMADSGPRPGFWVSLKGAIWGLLAPVIILGGLRLGLFTPTEA
AVVAVFYGLFVGVFILRTLSGRMLIDMLADAAEMSGVVLLIIALASVFAWAGSTLGAFDA
VAGAALQATDNEVVVLLMLNLLLLGLGMVLDAVSIFLILLPLLVPFMEAFHWDPVWFGVM
VTMNLAVGQFTPPMAVNLMVTTRIAGVRMEAATGWTLWFVGAMIVALMVVTFVPELTLWL
PRALGYL