Protein Info for Rru_A2226 in Rhodospirillum rubrum S1H

Annotation: Periplasmic Sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details PF00672: HAMP" amino acids 210 to 260 (51 residues), 30.1 bits, see alignment 7.3e-11 PF00512: HisKA" amino acids 265 to 321 (57 residues), 36.2 bits, see alignment 7.4e-13 PF02518: HATPase_c" amino acids 363 to 468 (106 residues), 83.3 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to rru:Rru_A2226)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS69 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Rru_A2226 Periplasmic Sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MIGLWGLDPAQPVLGRIRRILRLDHPLLRPFARAIKMILPKSLLGRSLLIIVIPLILLQV
ITATIFFDRHWDTMSRRLNAAVGSEIGMVLDFMAAYPDPEEREWMFALAYGRQQLAMRFE
PEATLPGTSPLAQDDDFVARTLYSSLAEHTDLPYQVDVIDDKTLEIRIAAPDGLLTVEVP
RKRLFSVTTYIFIGWMTVSSVILFAVATVFMRNQVRPIGRLASAADALGKGRDVPNFRSE
GALEVRRAALAFTRMRDRINRQIAQRTEMLAGVSHDLRTPLTRMRLQLALMEGEEGTVEL
TEDIAEMERMVEGYLAFARGEGTEETVATCITDLVDEVVGRMRRNGARIDLHTEQPLTVP
LKPNAMERCLANIIGNAHRFGQHIAVRVGVRDGHVEVVVDDDGPGIPPERREDVFRAFFR
IESSRNPRTGGTGLGLTIARDVVRAMGGDIFLENSPFGGLRARIRLPM