Protein Info for Rru_A2222 in Rhodospirillum rubrum S1H

Annotation: Molybdopterin biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF03453: MoeA_N" amino acids 26 to 187 (162 residues), 144.8 bits, see alignment E=2.8e-46 TIGR00177: molybdenum cofactor synthesis domain" amino acids 197 to 330 (134 residues), 92.7 bits, see alignment E=1.1e-30 PF00994: MoCF_biosynth" amino acids 200 to 335 (136 residues), 100.4 bits, see alignment E=1.2e-32 PF03454: MoeA_C" amino acids 354 to 424 (71 residues), 54.2 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to rru:Rru_A2222)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS73 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Rru_A2222 Molybdopterin biosynthesis protein (NCBI) (Rhodospirillum rubrum S1H)
MPASPPPSSLPPLSADCFDTADRLLALDDAVDRLLDLLGAVTAIERLPLDRALGRVLAED
LTSALVIPPDDNSAMDGYGVRFADLSPQAPTRLPLTLRVPAGHPADRPLGPGEAARIFTG
APIPEGVDTVIMQEVCHEEDGYVTLPSGEKRGANVRPAGADVAIGQTVLASGRRLGPIDV
AMAAQIGVAELAVRARLKVAVFTTGDEVVEPGQPLPPGGIYNSNRRALLGLLSTLGAECL
DLGNLPDRPALIQGALAEAARAADLVVTSGGVSVGGEDHVKDAVTALGSLAFWRLALKPG
KPLAFGTVAGKPFLGLPGNPVSTFVTFCLVGRPVVLRLAGVTGEQLQPRGFPVIADFSLT
RKPGRREFLRGQLRSDSSGAMVVAPFPVQSSNVVSSIVQSDGLIDIGQGVTVVSRGDRVR
FIPFSELF