Protein Info for Rru_A2218 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 19 to 201 (183 residues), 127.2 bits, E=9.1e-41
• PF08659: KR
  • amino acids 21 to 134 (114 residues), 33.7 bits, E=5.2e-12
• PF13561: adh_short_C2
  • amino acids 25 to 254 (230 residues), 126.2 bits, E=2.4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2218)

MetaCyc: 52% identical to dihydropterin reductase monomer (Agrobacterium fabrum C58)
RXN-23857 [EC: 1.5.1.50]; 1.5.1.50 [EC: 1.5.1.50]; Pteridine reductase. [EC: 1.5.1.50, 1.5.1.33]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• tetrahydromonapterin biosynthesis (2/4 steps found)
• folate transformations II (plants) (7/11 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33 or 1.5.1.50

Sequence Analysis Tools

See Q2RS77 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Rru_A2218 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MTEPSSALPQPPAPQTLPRVALVTGAARRLGRAMALELAGRGFDVAVHHRDSQADAEETA
RDVRALGQRAVVLSADLADVEETTALIAATGAALGPLGVLVNNASLFELDLWHSVTRQSW
DSHMDVNLRAPFLLSQGMAAALPEAATGVIVNLIDQRVWNLTPYFMTYTLSKAGLWTLTR
TLAMALAPRIRVNAIGPGPALPSPRQSEEDFARQAAATPLGHGTTPDEIARALGFILDAP
ALTGQMIALDGGQHLGWSQPGQTVSLGE