Protein Info for Rru_A2167 in Rhodospirillum rubrum S1H

Annotation: Phosphoribosylformylglycinamidine cyclo-ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 39 to 370 (332 residues), 441.9 bits, see alignment E=7.3e-137 PF00586: AIRS" amino acids 93 to 197 (105 residues), 75.6 bits, see alignment E=4.4e-25 PF02769: AIRS_C" amino acids 211 to 377 (167 residues), 125.5 bits, see alignment E=2.2e-40

Best Hits

Swiss-Prot: 100% identical to PUR5_RHORT: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 100% identity to rru:Rru_A2167)

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSC8 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Rru_A2167 Phosphoribosylformylglycinamidine cyclo-ligase (NCBI) (Rhodospirillum rubrum S1H)
MVRGTAPAAGAHPPRRTPVKNEVAISTSHLDAGATGTGLTYKDAGVDIDSGNALVQAIKP
LAASTKRPGADASLGGFGAIFDLAAAGYSDPLLITATDGVGTKLKIALDSGIHDSVGIDL
VAMCVNDLVVQGGEPLLFLDYFATSRLQVPVASAVVKGIAEGCLQAGCALVGGETAEMPG
MYGNNDYDLAGFAVGAVERSQLLTDDRIGLGDVLLGLASSGVHSNGFSLVRRIVERSGLA
WDAPAPFAPETTLARALLTPTRIYVKSCLALHRAGLVHGFAHITGGGFWENIPRVLPQGA
CAHLDGLSWPFPPVFRWLMDQGGVSAHEMARTFNCGIGMVVAVPADKAEAAIALLGEHGE
TVHRLGTIAARGEGEAVIIDHLDEAFAR