Protein Info for Rru_A2164 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0118 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 9 to 41 (33 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 209 to 262 (54 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details amino acids 304 to 335 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 13 to 336 (324 residues), 205.9 bits, see alignment E=4.8e-65

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2164)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSD1 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Rru_A2164 Protein of unknown function UPF0118 (NCBI) (Rhodospirillum rubrum S1H)
MNRDKQIRVWLIGILVFAVLIFLLRSVLLPFVTGLAVAYFLDPLADRLEKWGTSRLWAVI
WITLGFVLVMVLALLVLLPLINGQIADFVTNMPEYARALVGKGRALLDNLVDVLGPDRMS
DVTSSLEAAAGEATKWLGGLVNQLISGGAALINLVSVLVITPVIAFYMLRDWDVMVASID
RWLPRPYAPVIRAQMAEIDRTIAGFVRGQASVCLALGSFYAIGLTIGGLDLGLIVGMISG
LLSFIPYVGTITGFIVSMGLALAQFDSWIDTAIIAGIFVVGQMIEGNYLTPKLVGDRIGL
HPVWVIFALLAGGGLFGFLGVLLAVPLAAVIGVLVRFFLGRYLNSPLYTGATPEAPAVTR
VPPDNGAPE