Protein Info for Rru_A2163 in Rhodospirillum rubrum S1H

Annotation: conserved hypothetical protein RP631 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2163)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSD2 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Rru_A2163 conserved hypothetical protein RP631 (NCBI) (Rhodospirillum rubrum S1H)
MSAGVQLPLDLPWRPALGREHFLVAACNASAVALVEAWPHWPAPAACIHGPTGAGKTHLA
QVFATRAAAVVLDPAVILGTDPLTLFEGGRAAVIEDADRAGLPEATLFHLLNAARQRGGS
LLLTALSPPARWGVHLADLRSRLAALPAEGLCEPDDELMAAVLLKLFSDRGLDVAPGAIG
YLLPRMERSFAAARDLVVHADALALREGRAVTVPLLRQLLATPDRADR