Protein Info for Rru_A2114 in Rhodospirillum rubrum S1H

Annotation: O-antigen polymerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 40 to 57 (18 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 198 to 213 (16 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 374 to 391 (18 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF04932: Wzy_C" amino acids 202 to 353 (152 residues), 40.1 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2114)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSI1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Rru_A2114 O-antigen polymerase (NCBI) (Rhodospirillum rubrum S1H)
MTPNAPPRPSTVVFGGGRDWAALAALAAVPLTAALTHSQLVIPVGLIALLGLVTVALEDR
PLSARLPLRSPFLALGALIALWGLLSLGWTPTGKAAPRDAWTVVAIVLGTPLCARLLARP
VGEGPWGLMPRVMATVLGLCALLVFIETYSLWGPQVLIQGADAPVAKRVLAMNGVMSVLS
LLVWPTALALWIQGRRRWAIGLAVVVALAVARGTSEASLLGLCVGGLAFALALLAPVLVV
RLVSWGMAVVMVASPLVIKAVFASGLFTLIAPHLGFSVQHRLLIWRFIADRLAEKPWMGW
GIAASRSFQDLRVPTAFHDGALGWVVRDLQIVPIHPHNMPLQLWFELGVVGVVPVLIGLG
LLGWRLGKLADGRLATATVAGLLASGLTMAMGTYNLWQGWVLCAAAVAGCLMAGALATGR
QGRC