Protein Info for Rru_A2105 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 40 to 53 (14 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 279 (268 residues), 76 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 100% identity to rru:Rru_A2105)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSJ0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Rru_A2105 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MSLIAFLGAVESGLIFGLVALGVFLSFRILDFPDLTVDGSFPLGGAVSATLIVSGWDPFL
ATAIAIVAGAMAGAVTALLNVKLRILHLLASILTMIALYSVNLRIMGRPNVALLMEPTVF
SLVEAPGMPSRSWMIPAVLLVVIVLALIAFNLFMASRAGLAMRATGANARMAGAQGVSTA
GAIVLGMAMSNGLVALAGALFAQSQGGADVTMGVGVIVVGLASVIGGEAVMPTRTVLLAS
IACVIGAIMYRLAVALALNADSIGLQAQDLNLITAVLVAVAMVLPGSRASLRRNFRRVLG
LGDGNGGGGARP