Protein Info for Rru_A2100 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF81 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details amino acids 207 to 209 (3 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF01925: TauE" amino acids 18 to 288 (271 residues), 174.1 bits, see alignment E=2e-55

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to rru:Rru_A2100)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSJ5 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Rru_A2100 Protein of unknown function DUF81 (NCBI) (Rhodospirillum rubrum S1H)
MQIYLPIAEMSVNVLLILGMGGVVGFLSGLFGVGGGFLLTPLLILYGVPPAVAVGTQANQ
IVATSVAGVLAHMRRGNVDFKMGFVLLIGGLAGSVVGVWLFALLHRLGQIDLAISLSYVI
FLGAVGGLMFVESATVLIRRRRSPGVPVARGPGRHTWMHGLPLKMRFRRSKLYISAILPL
TIGFLVGILAAIMGVGGGFVMVPAMIYLLGMPTQVVVGTSLFQIIFVAASTAILQAAVNQ
TVDVVLALLLLAGAVFGAQAGAKAGARLRGEQLRALLAVMVLLVCGKLAYDLMATPGEMF
SFGALLD