Protein Info for Rru_A2068 in Rhodospirillum rubrum S1H

Annotation: Methylglyoxal synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02142: MGS" amino acids 35 to 117 (83 residues), 48.9 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 50% identical to MGSA_LEPBJ: Methylglyoxal synthase (mgsA) from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 100% identity to rru:Rru_A2068)

MetaCyc: 51% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSM7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Rru_A2068 Methylglyoxal synthase (NCBI) (Rhodospirillum rubrum S1H)
MSHSPETPPRMTIGLVAHDGQKRAMGQWVAANATVLGHHALVATGTTARVLKEQNPTFDI
TGLKSGPFGGDQQLGALIAEGHLDCLIFFVDPMEPQPHDVDVKALIRLAQVHEIPAACNR
ATADLMITSPLFGVLRAGSFPPAEERFAVYANRKV