Protein Info for Rru_A2056 in Rhodospirillum rubrum S1H

Annotation: Carbonate dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00484: Pro_CA" amino acids 37 to 188 (152 residues), 179.1 bits, see alignment E=3.8e-57

Best Hits

Swiss-Prot: 52% identical to CAN_ECOLI: Carbonic anhydrase 2 (can) from Escherichia coli (strain K12)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to rru:Rru_A2056)

MetaCyc: 52% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSN9 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Rru_A2056 Carbonate dehydratase (NCBI) (Rhodospirillum rubrum S1H)
MDIQDLITNNRKWAEERESALPGYFHILSEVQSPKFLWIGCSDSRVPANEIVGMQPGELF
VHRNIANVVPHADANCHAVLEYAIDVLKVEHIMVVGHYGCGGVRAALNRLAMGPIDNWLS
HIKDIARIFAAELEDLPDEESRVDRLCELNAMAQVMNVARTSMVQAAWRRGQPLAIHAWC
YGLKTGLVNDLGRTLTRIADLPEPYRLIFPDQV