Protein Info for Rru_A2052 in Rhodospirillum rubrum S1H

Annotation: RND efflux system, outer membrane lipoprotein, NodT (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 23 to 479 (457 residues), 437.1 bits, see alignment E=3.9e-135 PF02321: OEP" amino acids 77 to 267 (191 residues), 87.9 bits, see alignment E=3.7e-29 amino acids 298 to 477 (180 residues), 101.6 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 54% identical to ARPC_PSEPU: Antibiotic efflux pump outer membrane protein ArpC (arpC) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2052)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSP3 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Rru_A2052 RND efflux system, outer membrane lipoprotein, NodT (NCBI) (Rhodospirillum rubrum S1H)
MPRNSLSQRTPIMRSSLMSCVAVLALLGGCSFIPDYQRPAAPVPTAWPDGPAYDQAQAGG
ETIATLGWREFFRDPALQRLIAQALEHNRDLRSAALTVESARATYRIERADLLPTVNGGT
DLTHQRTPRTATQTGKAQTTTNYSANIGTTSYEIDFFGRIRSLEEEALEQYFATEEARRS
VQIALIAEVANAYITLLADRTLLQLTEETLNTRIESFNLTQQSFDRGVGTRLDVTQAQTT
VETARANRAIYTRYVAQDINALRLLVGDQLDANLLAGTPPLDLGRFFPNVPAGLPSDLLL
RRPDILEAEHKLVAANANIGAARAAFWPKISLTGNLGTASASLGDLFSSGSLAWSVGPSL
SVPLFDFWRNEATLESAKVQREIAVAAYEKSIQTAFREVADALAAKGTLGDQLRAQQDLV
AATQESYALSRNRYDQGIDNYLSTLDSQRSLYAAQQDLISVRANQLTNYITLYKVLGGGS
FATSPSELPNPAASVSTFP