Protein Info for Rru_A2048 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 25 to 166 (142 residues), 125.6 bits, see alignment E=2.2e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 39 to 331 (293 residues), 360.5 bits, see alignment E=3.8e-112 PF08402: TOBE_2" amino acids 283 to 360 (78 residues), 46.3 bits, see alignment E=3.9e-16

Best Hits

Swiss-Prot: 49% identical to POTA_ACIC1: Spermidine/putrescine import ATP-binding protein PotA (potA) from Acidothermus cellulolyticus (strain ATCC 43068 / 11B)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to rru:Rru_A2048)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSP7 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Rru_A2048 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MGDAEALVRFRGVQKTYDGQTLVVRDLDLDIRRGEFLTLLGPSGSGKTTSLMMLAGFEVP
TQGDILLAGRSVRDTPPHKRDIGMVFQNYALFPHMTVAENVAFPLSVRGMLKSDQRDRAL
RALAMVRLENLGNRRPAQLSGGQQQRVALARALVFEPTLVLMDEPLGALDKQLREHMQIE
IKHLHESLGLTVVYVTHDQSEALTMSDRVAVFSDGVIQQLDSPSGLYEQPRNSFVARFIG
ENNTLNGVVESVAEGYATVRLATGEALRARAVAIDGPGAKTSVSIRPERVHIEGEPEGPV
SRLAGVVSETIYHGDHMRVRARVGGNDEFTIKMRYRAGRPIPKAGEALSVILGAEDCLAL
DPV