Protein Info for Rru_A2034 in Rhodospirillum rubrum S1H

Annotation: Phosphate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 21 to 50 (30 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 414 to 430 (17 residues), see Phobius details amino acids 468 to 493 (26 residues), see Phobius details PF01384: PHO4" amino acids 78 to 486 (409 residues), 359.1 bits, see alignment E=1.2e-111

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to rru:Rru_A2034)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSR1 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Rru_A2034 Phosphate transporter (NCBI) (Rhodospirillum rubrum S1H)
MISPSGPKNMKKLHKELKRFSAIEAGLAITGRPAVGIGLAVVFLGVIWAFTAMTFGQTPS
HTFLVLAAVVGGYMALNIGANDVANNMGPAVGSRAMTMAGALLIAAICEASGAILAGGDV
VETISKGIIDPGAMSDNVKFVQVMIAALLASALWVNLATYLNAPVSTTHAIVGGVMGAGA
LAAGVGAVHWSTVGAIVASWVISPMMGGVIAAALLLFVKKMILFQDDKIAAARRWIPVLI
GLMAGAFGMYLLTKGLARVYAPPSWLVGLAGVGSFLGVWALMRPIVRRQTVEMENRRKAV
SGLFTHALIFSSALLSFAHGANDVANAVGPLAAIANALAGGGVEDQAVVLPLWILVVGAA
GISAGLFLFGPKLIRTVGEKITKLDRARAFCVSLSAAVTVLAASGLGLPVSSTHIAVGAV
FGVGFLREALANHQELSHLVHPPRLDAIDNPQRVEKLERRRLVRRQHITTIGAAWVVTVP
LSAALSAGLYLLLTAFLE