Protein Info for Rru_A2033 in Rhodospirillum rubrum S1H

Annotation: PAS/PAC Sensor Hybrid Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 866 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 352 to 483 (132 residues), 74.9 bits, see alignment E=3.1e-25 PF13188: PAS_8" amino acids 356 to 397 (42 residues), 26.6 bits, see alignment 1.5e-09 PF00989: PAS" amino acids 357 to 415 (59 residues), 40.4 bits, see alignment 9.3e-14 PF13426: PAS_9" amino acids 367 to 477 (111 residues), 36.6 bits, see alignment E=1.6e-12 PF00512: HisKA" amino acids 498 to 563 (66 residues), 77.9 bits, see alignment 1.7e-25 PF02518: HATPase_c" amino acids 610 to 721 (112 residues), 99.6 bits, see alignment E=5.2e-32 PF00072: Response_reg" amino acids 741 to 853 (113 residues), 94.6 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2033)

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSR2 at UniProt or InterPro

Protein Sequence (866 amino acids)

>Rru_A2033 PAS/PAC Sensor Hybrid Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MPRRMRDGLRQGLGSTLGRRVTRSLLIGIVVLEILVVAPSAILHRRSLLDDLEADARALG
LAAAAPPEASLGEWGRRLGVLLGDERITGAQLLRNDFAVAGIGDRPDSHPGSQGRHADDG
HSLDIAIPLTASETLTLRLDKHTITKKLWTEIGWLALMTLVMAAAVILIAAIVAGRLVLL
PLLDLRRLVVDIRPGEGRGPSSEAIGRTDELGDLFRAVEDLRRRIEMSLLEAATQARFPS
ENPNPVIRTSDSGGLLYANASARLRPGFLDGETLHPTIIALVRETTGRGEIMTSEIRLGT
RIYLLTAVPITHDRYVNIYASDVTDRVKAEIALRSLNESLEAQVLTRTRDLAESEARTRA
IIATMVDGLIVMDDQGRIDLFNAAAQRIFGYDESEVVGQNAALLMSAEDAAGHAEPFGLH
LWDGRSPLLNGTRKVIGRRKNGASFPLAVAISALPAPPPGGAPARRLFTGVVRDISDQIR
HESDLRKVKDEAEVANRAKSDFLAVMSHELRTPLNGVLGMADLLCDTPLDAEQRRYTRTI
AISAEALLVIINDILDLSKIEAGHLDLESRPFDPATLLEGVRTLMEGPARDKAIALRTSI
EGAKPPLRLGDEGRLRQILLNLANNGVKFTEKGSLTLRLKAGTGGALRFEVEDTGIGIPK
EKQDTLFHDFTQVSASTARRFGGSGLGLSICRRLVGLMGGRLGFDSTPGVGSLFWFEVDL
PEVVASQSPPPPPFQGPPLSILVVEDNEINRQVALGLLTKLGHRVTCVDDGAAAVRVVDT
MPFDLILMDVQMPGMDGYEATRLIRGKPAPVGGLPIVAMTANATSGDVAAAMAAGMTGYL
SKPITRKRLAEALMAHGPGATVSTTG