Protein Info for Rru_A2024 in Rhodospirillum rubrum S1H

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 14 to 373 (360 residues), 316.4 bits, see alignment E=1e-98 PF03054: tRNA_Me_trans" amino acids 14 to 213 (200 residues), 232.9 bits, see alignment E=5.9e-73 PF00733: Asn_synthase" amino acids 15 to 95 (81 residues), 25.9 bits, see alignment E=1.6e-09 PF20259: tRNA_Me_trans_M" amino acids 230 to 283 (54 residues), 61.1 bits, see alignment 1.2e-20 PF20258: tRNA_Me_trans_C" amino acids 291 to 373 (83 residues), 54.9 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 100% identical to MNMA_RHORT: tRNA-specific 2-thiouridylase MnmA (mnmA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to rru:Rru_A2024)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSS1 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Rru_A2024 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSQTPLSPPPVGGRVVVAMSGGVDSSVTAALLKEQGHDVVGLTMRLYDHGKPLGPGARTC
CAGQDIHDARRVADRLGIAHYVLDYESRFREDVIEPFAASYGRGETPIPCVLCNQTVKFR
DLLAAALDLGGTALATGHYVRRLDGPEGPRLYRAVDPGRDQSYFLFATTKGQLGRLLFPL
GAMASKDETRAIARRLGLAVGDKPDSQDICFVPDGDYAKVVERLRPGVVEAGEIVDLDGT
VLGHHPGLIHFTVGQRRGVGIGGSAEPLYVIALDTATHRLVVGPHAALARREIAVSGLNW
LGEGEGPASAGTRARIKIRHASPPFPGQIFPGAAAGEARVVLDEPAHGVAPGQAAVFYGL
DDNDARVLGGGWIGASR