Protein Info for Rru_A2011 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF00005: ABC_tran" amino acids 32 to 191 (160 residues), 92.9 bits, see alignment E=1.7e-29 amino acids 308 to 458 (151 residues), 110.5 bits, see alignment E=6.2e-35 PF08352: oligo_HPY" amino acids 242 to 272 (31 residues), 30 bits, see alignment (E = 3.3e-10) amino acids 510 to 535 (26 residues), 27.2 bits, see alignment (E = 2.5e-09)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to rru:Rru_A2011)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RST4 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Rru_A2011 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MTAPTLPLASPRLIIDDLRVALPKSADRPFALNGISLTVGADEIVCLVGESGSGKSMTAG
AIMRLLGPSTPITGGRILLEGVDLLGLSEAAMRAVRGARVGMIFQEPMTALNPLHTIGDQ
IAETFRTHGTLGRAEIERRVLDLLAEVLIPDPVAAAKAYPHELSGGQRQRAMIAMALALE
PALLIADEPTTALDVTTQAQILALIRDLQRRKGTGVLFVTHDFGVVAEIADRVAVMRGGE
VVEEGAAAQVLNHPLHPYTRALIAAVPPLVPAPPRPVTGPPLLRVEGLSKTYRSGGFFGR
GGRVTHAVKDVSFTLRRGATLGIVGESGSGKSTLARCVVRLLTSESGSIHLDDIDLSALT
DNDWHRESRRIQMVFQDPYGSLNPRRRVGELVAQGPIVRGAPRREVEARVRELFALVGLD
PKAVDRFPHEFSGGQRQRIGLARALALDPDVLVADEAVSALDVSVQAQVLALLADLRERL
NLSVLFITHDLRVAGQIADDILVMKDGAVVEAGPTARVFADPHHPYTKTLMAAVPGRAWM
PPVTAADRRADDPAPVPLGL