Protein Info for Rru_A1997 in Rhodospirillum rubrum S1H

Annotation: carboxylesterase family protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF20434: BD-FAE" amino acids 53 to 244 (192 residues), 75.7 bits, see alignment E=5.7e-25 PF07859: Abhydrolase_3" amino acids 71 to 168 (98 residues), 48.8 bits, see alignment E=1.1e-16 PF00326: Peptidase_S9" amino acids 142 to 263 (122 residues), 34.5 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1997)

Predicted SEED Role

"COG0657: Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSU8 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Rru_A1997 carboxylesterase family protein (NCBI) (Rhodospirillum rubrum S1H)
MKAPSPPLRALLMTALSPLFAACTVGTLNAIIPSDGYRSQTNVAYGPDPRQRLDVHVPVA
AAPADGRPVAVWIYGGSWQSGARGDYAFIADTLAALGWITVIPDYRLFPEVRFPAFVEDT
AQAVAWTRSEQARDILGPTNGTLVLMGHSAGAYNAAMVAYDPQWLRAARADPAMVSGFVG
LAGPYNLFPYDVEVTKRVFGHETDPTVVEPLSHITAASPPALLVTGLRDTVVGPYHTDAM
EAALAAKGVDHRTVRLADANHAGVVLGLTRYFRDKALTVPLAAFLKGLEKPAPRHDG