Protein Info for Rru_A1995 in Rhodospirillum rubrum S1H

Annotation: Divalent cation transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 365 (28 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 413 to 439 (27 residues), see Phobius details amino acids 451 to 474 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 52 to 474 (423 residues), 281.1 bits, see alignment E=7.5e-88 PF03448: MgtE_N" amino acids 60 to 160 (101 residues), 75.5 bits, see alignment E=6.5e-25 PF00571: CBS" amino acids 164 to 221 (58 residues), 17.3 bits, see alignment 7.3e-07 amino acids 228 to 282 (55 residues), 32.7 bits, see alignment 1.1e-11 PF01769: MgtE" amino acids 346 to 469 (124 residues), 131.6 bits, see alignment E=3.1e-42

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to rru:Rru_A1995)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSV0 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Rru_A1995 Divalent cation transporter (NCBI) (Rhodospirillum rubrum S1H)
MAGLGDREKTGDRDKTQDDAAPAEDGFGLSRDQIEAVRAALDDEEAARGAETARALVLRL
HYADQADLVQSLPAEDRRALIGALKGAFDPEILPELDDYVRDEVIETLGYQDLAQALAEL
DSDDALYVVAQLDEAEQAAVLERLPVATRALIEQGLSLPEYSAGRLMQRELVAVPAYWSV
GETLDYLRSAPRLPEDFHEIYVVDPRHRPVGQLRLSTLLRSQRSIRLRDIMDAEMPPLST
TADQGEVARLFRDRNLMSAPVIDVSGRLVGRITVDDVLDVIEEEAEDDMLRLAGVAEVDL
YRAVVDTVKARASWLGVNLITAILASLVIGLFEATLQSIVALAVLMPIVASMGGNAGTQA
LTVAVRSLATKELTPSNAWRIIGKEFLVGILNGVVFAVLIGAIAWIWFDRPEIGLIIAAA
MVINLAVAGLSGIVIPLALERMRIDPAIASAVFLTTITDVVGFFAFLGLASLFLMP