Protein Info for Rru_A1971 in Rhodospirillum rubrum S1H

Annotation: PfkB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03828: 1-phosphofructokinase
  • amino acids 14 to 322 (309 residues), 339 bits, E=2.2e-105
• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 15 to 322 (308 residues), 337.7 bits, E=4.9e-105
• PF00294: PfkB
  • amino acids 18 to 308 (291 residues), 185.9 bits, E=5.8e-59

Best Hits

Swiss-Prot: 54% identical to K1PF_XANCP: 1-phosphofructokinase (fruK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to rru:Rru_A1971)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• fructose degradation (1/1 steps found)
• galactitol degradation (2/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• lactose degradation I (1/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

See Q2RSX4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Rru_A1971 PfkB (NCBI) (Rhodospirillum rubrum S1H)
MSSDPSALPSALIVRTLTLNPAIDQTITLEALTPGTVHRARATRSDAGGKGINVAACLAD
WGESVAVYGVLGRDNSGPFDALFAAKGMIDRFVRIPGETRTNIKLVSSGGGPTTDINLPG
LEIDRPCLERVATALLADLAPGTPVVLSGSLPRGLDDKTYVGLVGALRERGAKVVLDVSG
WPLTRALEAPADHLPHCVKPNRHELESWAGRALPTLADVQEAAHGLRGKGVARVVVSLGS
DGALFVSDEGALHAKLPAMTALSTVGAGDAMVAGLVAALRQDLGLEDTARLATAFAAAKL
RHVGAQLPGRDVVLALAGQTHIARLQA