Protein Info for Rru_A1971 in Rhodospirillum rubrum S1H

Annotation: PfkB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR03828: 1-phosphofructokinase" amino acids 14 to 322 (309 residues), 339 bits, see alignment E=2.2e-105 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 15 to 322 (308 residues), 337.7 bits, see alignment E=4.9e-105 PF00294: PfkB" amino acids 18 to 308 (291 residues), 188.3 bits, see alignment E=1.1e-59

Best Hits

Swiss-Prot: 54% identical to K1PF_XANCP: 1-phosphofructokinase (fruK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to rru:Rru_A1971)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSX4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Rru_A1971 PfkB (NCBI) (Rhodospirillum rubrum S1H)
MSSDPSALPSALIVRTLTLNPAIDQTITLEALTPGTVHRARATRSDAGGKGINVAACLAD
WGESVAVYGVLGRDNSGPFDALFAAKGMIDRFVRIPGETRTNIKLVSSGGGPTTDINLPG
LEIDRPCLERVATALLADLAPGTPVVLSGSLPRGLDDKTYVGLVGALRERGAKVVLDVSG
WPLTRALEAPADHLPHCVKPNRHELESWAGRALPTLADVQEAAHGLRGKGVARVVVSLGS
DGALFVSDEGALHAKLPAMTALSTVGAGDAMVAGLVAALRQDLGLEDTARLATAFAAAKL
RHVGAQLPGRDVVLALAGQTHIARLQA