Protein Info for Rru_A1964 in Rhodospirillum rubrum S1H

Annotation: Adenylosuccinate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00709: Adenylsucc_synt" amino acids 7 to 146 (140 residues), 99.2 bits, see alignment E=1.1e-32 amino acids 149 to 288 (140 residues), 123.7 bits, see alignment E=4.3e-40

Best Hits

Swiss-Prot: 53% identical to PURA_THEGJ: Adenylosuccinate synthetase (purA) from Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 100% identity to rru:Rru_A1964)

MetaCyc: 58% identical to succinylo-toyocamycin phosphate synthase (Streptomyces rimosus)
6.3.4.-

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.4

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSY1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Rru_A1964 Adenylosuccinate synthase (NCBI) (Rhodospirillum rubrum S1H)
MVGCCTVVAGGQWGDEAKGKISAYLSLTDGIDVAARAGLGPGAGHTVVSAGTTLKLRQLP
AAVVRPQTTLLLGAGVMVNPAVFLAEVADLGAGRRVGLDPRASIIDEAHRRTDREDPHLT
TTIGSTGSGHGPCLADRALRRGRLAGEVAALAPYLADVAELLNQALDDGRKVLIEGTNGF
LLSVLYGTYPHTVGKDSTAATIAADVGLGPTRINRVVLAFKAFPTRVGGGPFPTELPRAE
IEARGFLEQGTVTGRPRRVGTFDFAAAGRAARINAPTDIALTFLDRIDPECRGRPFDRLS
RAARAFIDQVEDACRAPVTLIGTGPDTFDILDRRGER