Protein Info for Rru_A1963 in Rhodospirillum rubrum S1H

Annotation: Adenylosuccinate lyase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 219 to 236 (18 residues), see Phobius details TIGR00928: adenylosuccinate lyase" amino acids 1 to 425 (425 residues), 442.8 bits, see alignment E=6.4e-137 PF00206: Lyase_1" amino acids 62 to 283 (222 residues), 169.2 bits, see alignment E=1.5e-53 PF10397: ADSL_C" amino acids 352 to 426 (75 residues), 56.8 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 49% identical to PUR8_SYNY3: Adenylosuccinate lyase (purB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to rru:Rru_A1963)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.2

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSY2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Rru_A1963 Adenylosuccinate lyase (NCBI) (Rhodospirillum rubrum S1H)
MIGRYRRAEMAAVWERESRYWLWLEIETAVLDAQAALGVVPAEAALAVRRARIDSAAIDR
LEATLRHEVIAFLTHIADQMGEEGRYLHYGLTSSDILDTALALQLTRAGAILEDGLARMI
AALEDQVRRHRRTPCLGRTHGMAAEPTTFGLKLAGHLAEFQRARTRLAWALREIAVCKIA
GAVGTYATVDPKVEAQVAAQFGLAVETAATQVVPRDRHAVFFAVLAVIAGAVERLATEIR
NLQRIEIGEVEEPFPSGQKGSSAMPHKRNPLFCETLCGLARVVRAGVVPALENMVLWHER
DMSHSSVERVVAPDTTLVLDYALHSLAAIVEGLTVHPERMAENLARYGQSCWSQKALLVL
VGAGMSREAAYRLVQGHALAAATGGASFLERLLADPELPQAITPDTLAGLDDPLAFLDHA
AIAIDRALGGEEG