Protein Info for Rru_A1952 in Rhodospirillum rubrum S1H

Annotation: Fusaric acid resistance protein conserved region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 419 to 436 (18 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details amino acids 471 to 488 (18 residues), see Phobius details amino acids 495 to 516 (22 residues), see Phobius details amino acids 523 to 550 (28 residues), see Phobius details PF04632: FUSC" amino acids 38 to 695 (658 residues), 572.7 bits, see alignment E=2.6e-175 PF06081: ArAE_1" amino acids 43 to 148 (106 residues), 23.6 bits, see alignment E=9.7e-09 PF13515: FUSC_2" amino acids 50 to 180 (131 residues), 57.3 bits, see alignment E=3.6e-19 PF11744: ALMT" amino acids 64 to 187 (124 residues), 26.5 bits, see alignment E=6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1952)

Predicted SEED Role

"COG1289: Predicted membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSZ3 at UniProt or InterPro

Protein Sequence (704 amino acids)

>Rru_A1952 Fusaric acid resistance protein conserved region (NCBI) (Rhodospirillum rubrum S1H)
MSISPPANRSPERTDTARAGAVWHFLRAPATKADADAALFSVKSFAAAMLAYYIALRIGL
PKPFWAIVTVYIVSQTSAGASLSRGVYRLAGTIAGAVATVAIVPNVVNDPIACSAALACW
IGLCLFFSLLDRTPRAYAFVLAGYTASLIGFPSVLDPGAVFDTASARVQEISIGILCAVL
AHRYVLPKPMTGQFTGKLSATLRYARWLAGDALNGTRGENRHDRTQLAVDLLALQGLATH
LPYDAATASPRREKRRLIHDRLARLLPLATEIEERIHCLGAGGYQAPEDLIDLLGAVGTW
IASVDLGEREGGAIALIARARLIQKRLGADAAMPGDRLAANLAGHLAEMIGLLRDCDRLG
QTIATADRPRERASLHGPRRAKGYVYHRDPWMAGRAALGAIVGILIGCAFWIWSAWPEGG
TAVSIFGVCCTLFGNVDAPVPNVLKYMVGLIYGVAISLAYNFVILPQVTDFAVLVAVLAP
AFLFAGSLQARPPTTFLALGITLTIPILSGLGTAYAGDFAASLNTVIAVFMAIGFGMVSM
SLFQTIPVDAAITRLLHLSRRDVSRRALGGAPNEAHWTSLMIDRTALLLPRVRASRNTHW
DLLDDTLRHLRLGHAVGQLRKTIPQLKGEVGNEVNDLLCAIAAGFSAKAPRGPVDPLEFD
RRIDTVTTRVAGSAIKTRLRVLDLLLDLRFALGSSNTADGTPTP