Protein Info for Rru_A1934 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, TetR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF00440: TetR_N" amino acids 23 to 67 (45 residues), 44.9 bits, see alignment 8.2e-16 PF17932: TetR_C_24" amino acids 94 to 196 (103 residues), 75.2 bits, see alignment E=5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1934)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT11 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Rru_A1934 Transcriptional Regulator, TetR family (NCBI) (Rhodospirillum rubrum S1H)
MTRWKTTDLDSAALFQRKRDAVIHEAAQAFSRFGYHGTSLDDIARVLNVTKAALYYYVAS
KQELLAHCHAIGLGICEASLADGRAKATSGLDAIDGFVRAYVDRATGELGVCLLIGDLSC
LAPAARTEVMARRDAFEGSLRDLIRAGREDGGIRPDVDPKLSCFQILGALNHIPRWYSPT
GPNSPAELAQYFARQIHASLSI