Protein Info for Rru_A1927 in Rhodospirillum rubrum S1H

Annotation: Acetyl-CoA hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR03458: succinate CoA transferase" amino acids 14 to 494 (481 residues), 762 bits, see alignment E=1.2e-233 PF02550: AcetylCoA_hydro" amino acids 14 to 215 (202 residues), 103.5 bits, see alignment E=1.6e-33 PF13336: AcetylCoA_hyd_C" amino acids 329 to 463 (135 residues), 136.6 bits, see alignment E=6.8e-44

Best Hits

Swiss-Prot: 52% identical to CAT1_CLOK5: Succinyl-CoA:coenzyme A transferase (cat1) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: K01067, acetyl-CoA hydrolase [EC: 3.1.2.1] (inferred from 100% identity to rru:Rru_A1927)

MetaCyc: 52% identical to succinyl-CoA:CoA transferase (Clostridium kluyveri)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18 or 3.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT18 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Rru_A1927 Acetyl-CoA hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MYRDRIRHPSLFGKVVSAEEAASLIKDGMTVGMSGFTRSGEAKAVPFALAERAKTDPLKI
TLLTGASLGNDLDKTLVEAGVLARRLPFQADPALRKAINRGEVMFIDQHLSETVEMLRTR
QLGPIDVAVVEAVAITEDGGIIPTTSVGNSATFAILAEKVIIEINLSQPVELEGLHDIYI
PTRRPFREPIPIVACESRVGLPFIPIDPSKIAAIVVTEKKDSAATVAPPDADTRAIAGHL
IEFLRHEVSLGRLSNTLQPLQAGIGSIANAVLHGLIESPFHSLKMYSEVLQDSTFDLFDA
GKLLFASGSSITLSEEKYRAVLPNLPSYKNRILLRPQEISNHPEIIRRLGLIGINTALEF
DLYGNVNSTHVGGTMMMNGIGGSGDFARNCYLSVFVTKSIAKNGAISSVVPMVSHVDHTE
HDVDILITEIGLADLRGLAPRERAKVVIDNCVHPAYRDQLADYYRRALTRGGHTPHLIEE
AFSWHVRAAKTGSMREAVAAD