Protein Info for Rru_A1924 in Rhodospirillum rubrum S1H

Annotation: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 164 (16 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF13231: PMT_2" amino acids 73 to 236 (164 residues), 47.3 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1924)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT21 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Rru_A1924 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI) (Rhodospirillum rubrum S1H)
MTAIAFWLRRPFDRALPAARALVASPLALALAVALLLGLQLAIQGAVFSGFPRDEIESIF
WGQGWALGYDIQQPPLHNWIAGLTTAGLGVTPLAFALIRMGTIALMLLFVWLGTRAAAGG
DRVAAGLAVLGLLASVMFGLQIFLNLTHTLTLLCAVAFCFWTLTRVARPEAGLGAYLLVG
LGLGLGALAKYSFALVALGLLIGALTHPILRRRLIDWRTLAALAVAGLIVTPHGLWLRGA
DHTVLAEMPELLHAAPLPPLQRAWDILRTGWIDPLAGVIVPLALLALCLPGFVKPGLPTS
AGDPSRPWRRLLIVAVVTTLALVTLVTLAAGGNRLRDHYLMPAALLLPIWAALRATALRR
GAPAEGRAAFGLCAAAALLAAGLALAMTVIRPLTCDRCLTDLPVDRWEQAVREAGFDGGT
LVSGSLDNAAALFTRFPGSRLVWRAPGVPLRGDGASTQGEGCLIVLDPKRPEADRQSLEG
WLAEHLEAPTPPAPPPLLQAEGRLRSVLGNRTETLYFVVYPQGIGQCR