Protein Info for Rru_A1912 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 7 to 197 (191 residues), 145.2 bits, see alignment E=3.6e-46 PF08659: KR" amino acids 9 to 167 (159 residues), 24.9 bits, see alignment E=3.5e-09 PF13561: adh_short_C2" amino acids 11 to 241 (231 residues), 198.4 bits, see alignment E=2.8e-62

Best Hits

Swiss-Prot: 51% identical to Y3106_PSEAE: Uncharacterized oxidoreductase PA3106 (PA3106) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A1912)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT33 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Rru_A1912 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MDHPRRACVTGAANGIGRAIALHLSRLGWSVAGLDRDGGGLAAMAAAAKAEGLAAPLLAT
VDVRDEAALAAALAQAAGPEETLHGLVCCAGRTTAHSGPPEDLALADWQKFIDINLTGPF
LCAKHAIKALERGRGAIVMIASTRAHQSEPGTEAYAASKGGLLALTHALALSLSNRVRVN
AISPGWIATSGVEDLRPEDHAQHPAGRVGLPGDIAAATAWLLSDDAGFMTGAELIVDGGM
TRKMIYRD