Protein Info for Rru_A1904 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 70 to 343 (274 residues), 129.5 bits, see alignment E=7e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A1904)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT41 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Rru_A1904 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MSRSSRFITLEARPEPSALWVWAAPLLAVGLTLIAGGLLFAALGKDPVAALAGFFLKPLS
SLYGLGELGVKAAPLALIAAGLAVGFRGGVWNIGAEGQLTMGAVVGGGVGLAFLESTGPL
VLPAMMLCGALGGMAWAAIPALLRTRFNANEILTSLMLTYVAQLLLSWLVHGPWRSPSGF
NFPETEMFGPAATLPVLIEGTRLHLGVVLALVVVGAIWVLLGRSFIGFQIKVMGLAPRAG
AYAGFSQRRVIWMAMLLSGGAAGLAGLFEVAGPIGQLQPAISPGYGFTAIIVAFLGRLHP
LGIVFAACFMALTYLGGETVQMDMGLPLAVTGVFQGMILFFLLAADVLIRYRIRLGRAAS
AKAL