Protein Info for Rru_A1900 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, AsnC family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13404: HTH_AsnC-type" amino acids 1 to 42 (42 residues), 57.5 bits, see alignment E=1.8e-19 PF13412: HTH_24" amino acids 1 to 47 (47 residues), 56 bits, see alignment E=4.8e-19 PF01037: AsnC_trans_reg" amino acids 67 to 140 (74 residues), 52.6 bits, see alignment E=6.8e-18

Best Hits

Swiss-Prot: 32% identical to DECR_ECOL6: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1900)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT45 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Rru_A1900 Transcriptional Regulator, AsnC family (NCBI) (Rhodospirillum rubrum S1H)
MDALDRRLVRLLQHDASLTNAALADRAGLSPSSCLRRVQRLRDEGVLTRTVMLADAQKLG
RGLTAIVQVFLNHHAHDRRREFLAHVRAEPAITQAWSVTGEADVILVLHLRDMAEYARLC
DLLFEHDPNVTKFQTLFALATYKSETAIGVDEPADP