Protein Info for Rru_A1898 in Rhodospirillum rubrum S1H

Annotation: SOS-response transcriptional repressor, LexA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00498: repressor LexA" amino acids 2 to 250 (249 residues), 156.1 bits, see alignment E=4.7e-50 PF01726: LexA_DNA_bind" amino acids 2 to 63 (62 residues), 46 bits, see alignment E=3.8e-16 PF00717: Peptidase_S24" amino acids 130 to 245 (116 residues), 99.3 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 100% identical to LEXA_RHORT: LexA repressor (lexA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 100% identity to rru:Rru_A1898)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT47 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Rru_A1898 SOS-response transcriptional repressor, LexA (NCBI) (Rhodospirillum rubrum S1H)
MLTRKQYLLLSFIDQRLKLSGVSPSFDEMKDALGLKSKSGIHRLIKGLEERGFLKRLPHR
ARALEVLRLPCNLTFDGDGEALDDGQPAPLFGGPLPETGFSPQVIRGNFTPTLPSTQVPQ
VLFTESISLPLLGKIAAGTPIAALIDPTSSIDVPASMVRGGEHFALRIEGDSMIEAGILS
GDLAVVRRCDEAENGTVIVALVDNEEATLKRLRRKGASIALEPANRAFKTQIYGPDRVRI
QGRLVGLIRSY