Protein Info for Rru_A1893 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF610, YibQ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details PF04748: Polysacc_deac_2" amino acids 196 to 408 (213 residues), 246.1 bits, see alignment E=9.9e-78

Best Hits

KEGG orthology group: K09798, hypothetical protein (inferred from 100% identity to rru:Rru_A1893)

Predicted SEED Role

"FIG00638667: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT52 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Rru_A1893 Protein of unknown function DUF610, YibQ (NCBI) (Rhodospirillum rubrum S1H)
MLDHPEDRGVLDRFAFFVARMAPLTLVLVALATLAVGLGIGFAVGRLAQGDKAAPPAPTA
LAAIGPLPVAPAAGEAAHQYQPPPLPRPAETAPPLPADVAPPVQTAPAPSETPAGEKGAL
PAEFRDLLASDGPGFVMEERLPDDAYVHKPQVKPTVKTAALAPVPRFPEGPAESSGLPWK
TYGVAAGKWSKPAIALVIDDMGLDRVRTEKVRKLAGPLTLAYLAYADGLAGQMRGGRKAG
HEILMHMPMEPLDAKVNPGPGALKVGLSDDEILTRLRRNLDGGAEFVGINNHMGSRFTAD
SRGMTLVMGELKKRGLLWLDSMTSANSVGLTLAEMAGVPHIGRTVFLDNLNDQAAVARQL
AKLEAAARQHGVAVGIGHPRDGTIGALSVWLPALAAKGITLVPISALVTTKDAELAHARP
SGKTASTSPSTD