Protein Info for Rru_A1869 in Rhodospirillum rubrum S1H

Annotation: Phosphatidylglycerophosphatase A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details PF04608: PgpA" amino acids 43 to 181 (139 residues), 143.9 bits, see alignment E=1.7e-46

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to rru:Rru_A1869)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT76 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Rru_A1869 Phosphatidylglycerophosphatase A (NCBI) (Rhodospirillum rubrum S1H)
MPLDAPPLLPSADSDSTVSILQAKGDAPPAAATAAVGWPLLALTTWFGSGLIPLAPGTMG
SIAALPFAWAIAWTWGPWALAPAAALVFVIGTLAAEAHVRRSGEKDPQRIVIDEVAGQWL
TLAVAPLDPLAYGVGLVLFRICDITKPWPACWADRSVPGGFGIMLDDGFAAVYSTCMMAL
YVHYFM