Protein Info for Rru_A1848 in Rhodospirillum rubrum S1H

Annotation: Gram negative topoisomerase IV, subunit A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 14 to 741 (728 residues), 883.5 bits, see alignment E=5.2e-270 PF00521: DNA_topoisoIV" amino acids 36 to 474 (439 residues), 485.1 bits, see alignment E=2e-149 PF03989: DNA_gyraseA_C" amino acids 608 to 643 (36 residues), 13.2 bits, see alignment (E = 4.9e-06) amino acids 653 to 690 (38 residues), 18.2 bits, see alignment 1.4e-07

Best Hits

Swiss-Prot: 61% identical to PARC_RHIME: DNA topoisomerase 4 subunit A (parC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 100% identity to rru:Rru_A1848)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT97 at UniProt or InterPro

Protein Sequence (743 amino acids)

>Rru_A1848 Gram negative topoisomerase IV, subunit A (NCBI) (Rhodospirillum rubrum S1H)
MSKGPVPEPLEIRETPLSEALSERYLAYALSTIVSRSLPDVRDGLKPVHRRLLYAMRMLK
LDPGSGFKKCARVVGDVIGKYHPHGDAAVYEAMVRLAQEFAVRYPLVEGQGNFGNIDGDN
AAAMRYTEARLTAVASALMEGLDDDAVDFRPTYDGEDHEPVVMPAAFPNLLANGSSGIAV
GMATNIPPHNVGELCEALLHLIKVPACPPEALLSFVKGPDFPTGGVLAEHPQAIAEAYRT
GRGAMRLRARWEKENLSHGLYQIVITEIPYQIQKAKLVERIAELINGRKLPILADVRDES
ADDLRLVLEPRNRTVDAETLMEQLFRLTDLEIRFNLNMNVLDGDGVPKVLGLKEALVAFL
DHRLVVLGRRSRHRLGKIEHRLEVLAGTLIAYLNLDEVIRIIREEDEPKPALMAAFGLSD
VQTEAILNMRLRSLRRLEEMEIRREHDALSAEKAGLEALLADEGLCWKVIAKQIRETRKT
FGGDTALGRRRTELGSAPTAVIVPIEALVEREPITVLLSERGWLRAVKGHQEPGEENKFK
EGDALLLALHAQTTDKLLILDSTGRFFTLPADKLARGRGFGEPVRLMLDLPNDADIVSLL
VHDPARRLILAASGGRGFVVEEKDVLAQTRAGKQVMTVDAGERALLCREVRGDHVAVIGQ
NRKLLVFPLTQVPVLARGKGVILQRYKDGGIADIKTFAIADGLTWKSGERTRTESDLTAW
LGDRAGLGRLPPQGFPRTNSFGP