Protein Info for Rru_A1841 in Rhodospirillum rubrum S1H

Annotation: Flavin reductase-like, FMN-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01613: Flavin_Reduct" amino acids 13 to 156 (144 residues), 144.1 bits, see alignment E=2e-46

Best Hits

Swiss-Prot: 40% identical to HSAB_MYCTO: Flavin-dependent monooxygenase, reductase subunit HsaB (hsaB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1841)

MetaCyc: 40% identical to 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione 4-hydroxylase reductase component (Mycobacterium tuberculosis H37Rv)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"NADH-FMN oxidoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTA4 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Rru_A1841 Flavin reductase-like, FMN-binding (NCBI) (Rhodospirillum rubrum S1H)
MPFDDRAFRKALGCFASGVTVITTLDAAQRPVGVTVSAFSSLSLDPPMVLFCLGKSTSNL
EAFRQGPVSISILAEGQQDLSIRFASRGVDKFAGLEMDTAPGGVPAPKDVLARLDCVITQ
TIEGGDHLIVLCAVEDLITRTGGQPLVYFRGSYTQVGVLPV