Protein Info for Rru_A1780 in Rhodospirillum rubrum S1H

Annotation: Deoxyguanosinetriphosphate triphosphohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR01353: putative dGTPase" amino acids 33 to 392 (360 residues), 330.8 bits, see alignment E=8.4e-103 PF01966: HD" amino acids 71 to 190 (120 residues), 45 bits, see alignment E=1.2e-15 PF13286: HD_assoc" amino acids 300 to 390 (91 residues), 106.9 bits, see alignment E=6.4e-35

Best Hits

Swiss-Prot: 64% identical to DGTL1_PARL1: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (Plav_3021) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to rru:Rru_A1780)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTG5 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Rru_A1780 Deoxyguanosinetriphosphate triphosphohydrolase (NCBI) (Rhodospirillum rubrum S1H)
MSIWTPKSPSLAPYASDPATSRGRLYPEASSPTRSPHQRDRDRVLHSAAFRRLKYKTQVF
VNSVGENYRTRLTHSLEVSQIARSVSRVLGLNEDLAEALALAHDLGHTCFGHAGEDALKD
CMAAYDGFDHNAQSLRIVTKLERRYAEFDGLNLTWETLEGLVKHNGPLIRPGEATLQDLP
AAILEYVDRHDLELSSFAGPEAQVAALSDDIAYNAHDLDDGLRAGLFPLEAVIEVPLVGP
LLRHVLDRYPGIEPSRAIHETVRRVITAMVDDVCAESARRLERQNPGSAAEVRALDAPVI
AFSEEMAQKDAGLKGFLFPTLYRHYRVNRMTSKARRVVREMFGLLVEEPMLLPDDWRART
TRPHSHKTARVVCDYIAGMTDRFALDEHARLFDPSVKP