Protein Info for Rru_A1779 in Rhodospirillum rubrum S1H

Annotation: Arginine--tRNA ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 564 to 585 (22 residues), see Phobius details PF03485: Arg_tRNA_synt_N" amino acids 7 to 94 (88 residues), 68.5 bits, see alignment E=1e-22 TIGR00456: arginine--tRNA ligase" amino acids 32 to 591 (560 residues), 334.1 bits, see alignment E=6.8e-104 PF00750: tRNA-synt_1d" amino acids 120 to 181 (62 residues), 36.4 bits, see alignment E=4.7e-13 PF05746: DALR_1" amino acids 459 to 591 (133 residues), 91.3 bits, see alignment E=6.9e-30

Best Hits

Swiss-Prot: 100% identical to SYR_RHORT: Arginine--tRNA ligase (argS) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to rru:Rru_A1779)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTG6 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Rru_A1779 Arginine--tRNA ligase (NCBI) (Rhodospirillum rubrum S1H)
MNVFHDIKETVLAQVAALQAEGRLPEGLETGRVAVEPPREAAHGDMATNAAMVLAKPAGL
APRAVAEMLVEKLVGVDGIVAAETAGPGFINLRLDPKIWRKTLKTVLTLGTAFGASTMGR
GAAVNVEFVSANPTGPMHVGHGRGAVFGDALAALLVKAGWAVTREYYVNDAGAQVDSLAR
ALYARYRVAVGDLDEAAFAAMLAAREIEYGGDYLVPVAADIAQADGTRWTTVAESDWLPA
FRAIGIERMLALIKEDLAALGVVHDVFTSEQALVRAGRVDEMMTDLESRDLVYVGTLEPP
KGKTPDDWEPRPQTLFRATGFGDEVDRPLKKSDGSWTYFASDIAYHHDKFKRGFLGMINV
LGADHGGYVKRLKAAVKAVSNGEAELDVKLVQLVKLLDNGEPVKMSKRAGTFITLREVVD
EVGKDVVRFIMLTRKNDAALDFDYARVTEKTRDNPVFYVQYAHARACSVARHAAQTFPGR
DLSAAALAATADLDLLDADEEMAMVRLLAGWPRLVESAAEAHEPHRVAFYLGEVAAAFHG
LWNRGNDNAELRFLLPTDEARSLARLALVQAVASVIASGLEIFGVEPVKEMR