Protein Info for Rru_A1771 in Rhodospirillum rubrum S1H

Annotation: Sec-independent periplasmic protein translocase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 216 to 231 (16 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 21 to 247 (227 residues), 217.9 bits, see alignment E=7.8e-69 PF00902: TatC" amino acids 23 to 242 (220 residues), 234.4 bits, see alignment E=6e-74

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to rru:Rru_A1771)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTH4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Rru_A1771 Sec-independent periplasmic protein translocase (NCBI) (Rhodospirillum rubrum S1H)
MAPADATRDEDSDLEDKKMPLIDHLIELRSRLLWSTVFFLVAFFACFAYAQEIYNILVLP
LARVMERVGGSQRMIYTALTEAFFTYVKVGAFGAIVLSFPLIATQIWMFVAPGLYRHEKR
AFLPFLIVSPMLFILGAAMVYYLVMPMAWSFLLGFQTTREQTVLPIQLEAKVGEYLGLVM
KLILAFGFSFQMPVALTLMARVGLVTSRGLAKARKYAIVAVFAGAAVITPPDIMSQVMLA
IPLLVLYELSIVAARMVEKSKGIEDDDLENLDDDEPPPAAAAPSTAHKRGGTTALAAPLA
RDEEAGADGDPGRFEETDWNHGH